USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
$0.00
Rebels Beanie

Rebels Beanie

$24.00 inc. tax

This high quality Rebels Beanie is perfect for keeping your head warm on cold winter days. The knit is 100% Acrylic and made of a top-seam knit, with a pom-pom on top for a touch of style and a solid cuff. This hat is one-size-fits-most to make sure you're always comfortable while wearing it!

  • Faux Leather Engraved Patch
  • 100% Acrylic
  • Pom-pom on top, solid cuff
  • 6 Top-seam knit
  • 12" knit
Product Code: R134
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Customer Reviews

No Reviews Posted Yet - be the first!

write review
Related Products
Rebel Hoops T-Shirt
Rebel Hoops T-Shirt
$16.00
Rebels 20oz. Tumbler
Rebels 20oz. Tumbler
$24.00
Rebels Hoops Warmup
Rebels Hoops Warmup
$24.00
Rebel Hoops Crewneck
Rebel Hoops Crewneck
$30.00
Rebel Hoops Hoodie
Rebel Hoops Hoodie
$36.00
Rebels Stadium Seat
Rebels Stadium Seat
$65.00
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i